PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0348s0040.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 456aa    MW: 52185.7 Da    PI: 4.2479
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0348s0040.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.73.9e-52171432128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                             ppGfrFhPtdeelv +yLkkk+ +k++el ++i+e+d+yk++P++Lp +  +k+++++w+fFs+rd+ky++g r+nrat++gyWk t
  SapurV1A.0348s0040.4.p  17 PPGFRFHPTDEELVLYYLKKKICKKRIEL-NIIRELDVYKWDPEELPgQsILKTGDRQWFFFSPRDRKYPNGARSNRATRQGYWKVT 102
                             8****************************.99**************96446788999****************************** PP

                     NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             gkd+ v++ ++++vg+kktLvfy grap+g++tdWvmhey+l
  SapurV1A.0348s0040.4.p 103 GKDRIVVC-NSRNVGVKKTLVFYIGRAPSGQRTDWVMHEYTL 143
                             ********.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6012166IPR003441NAC domain
PROSITE profilePS5100554.72316166IPR003441NAC domain
PfamPF023657.3E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MTVTADSCLG ADDKAWPPGF RFHPTDEELV LYYLKKKICK KRIELNIIRE LDVYKWDPEE  60
LPGQSILKTG DRQWFFFSPR DRKYPNGARS NRATRQGYWK VTGKDRIVVC NSRNVGVKKT  120
LVFYIGRAPS GQRTDWVMHE YTLYEEELNR CPNVQDYYAL YKVFKKSGPG PKNGEQYGAP  180
FKEEDWADDE YPCVNGMVTP EIPVEQHNEV SLVDNVRVSD QLEPLLDDFE EIIKQIAEEP  240
APNQLQNNDF THLLSQEVVS EPAGELMTSG QHYNKYTSFN FNQSATSTLQ LHEAPEVTSS  300
PNCEEAPQLN EEDFLEIDDL IDPEPSFFST EQPAENLKFD DFDGLSELDE YDDAAMFFHG  360
MGPVDQEAVS CSYMNSYACD VINQASYQLQ PNTITNLVDY HLQPNLVANQ VDYELQPQFF  420
DSEQMNSQLW VHDHQNNALA TSESHHGILF QSTGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-491716618165NO APICAL MERISTEM PROTEIN
1ut4_B4e-491716618165NO APICAL MERISTEM PROTEIN
1ut7_A4e-491716618165NO APICAL MERISTEM PROTEIN
1ut7_B4e-491716618165NO APICAL MERISTEM PROTEIN
4dul_A4e-491716618165NAC domain-containing protein 19
4dul_B4e-491716618165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044813.10.0PREDICTED: NAC domain-containing protein 69 isoform X1
SwissprotQ9XIC51e-122NAC17_ARATH; NAC domain-containing protein 17
TrEMBLB9H7Z30.0B9H7Z3_POPTR; No apical meristem family protein
STRINGPOPTR_0005s22180.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-116NAC domain containing protein 17